Product Added to your Cart
x

-------- OR --------

GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
Menu
0 items
Aroma Accessories
Sub-Categories
Aluminium Bottles EtcGlass Bottles & AccessoriesGemstone Roller Bottle and TipsAromatherapy Storage Boxes
2 product(s) found for "Aroma Accessories"
Aluminium Tin Box Round with..
Aluminium Bottles Etc
Aluminium Tin Box Round with..
Aluminium Tin Box Round with Screw Top - 70x35mm - Where Versatile Storage Meets Shiny Preservation Magic You cannot resist the adaptable charm of this beautifully functional aluminium tin box that proves...
£81.99
Units in Stock: 1
£81.99
Details
Add To Cart
Aluminium Tin Box Round with Screw Top - 70x35mm - Where Versatile Storage Meets Shiny Preservation Magic You cannot resist the adaptable charm of this beautifully functional aluminium tin box that proves...
Aluminium Tins - 38x19mm
Aluminium Bottles Etc
Aluminium Tins - 38x19mm
Aluminium Tins - 38x19mm - Where Compact Versatility Meets Shiny Preservation Magic You cannot resist the irresistibly compact charm of these beautifully functional aluminium tins that prove the best small...
£23.99
Units in Stock: 1
£23.99
Details
Add To Cart
Aluminium Tins - 38x19mm - Where Compact Versatility Meets Shiny Preservation Magic You cannot resist the irresistibly compact charm of these beautifully functional aluminium tins that prove the best small...
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i