Product Added to your Cart
x

-------- OR --------

GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
Menu
0 items
Jewellery Quarter
Sub-Categories
BraceletsEarringsNecklaces
52 product(s) found for "Jewellery Quarter"
Luna Moth Earrings
Light Luna moth
Luna Moth Earrings
This ethereal pair of earrings features dangling nickel-free stainless steel luna moths, making it an elegant piece to add to any jewellery collection. The luna moth symbolises change, inner guidance,...
£4.99
Units in Stock: 1
£4.99
Details
Add To Cart
This ethereal pair of earrings features dangling nickel-free stainless steel luna moths, making it an elegant piece to add to any jewellery collection. The luna moth symbolises change, inner guidance,...
Luna Moth Pendant Necklace
Light Luna moth
Luna Moth Pendant Necklace
This ethereal necklace features a dangling nickel-free stainless steel luna moth pendant, making it an elegant piece to add to any jewellery collection. The luna moth symbolises change, inner guidance...
£4.99
Units in Stock: 1
£4.99
Details
Add To Cart
This ethereal necklace features a dangling nickel-free stainless steel luna moth pendant, making it an elegant piece to add to any jewellery collection. The luna moth symbolises change, inner guidance...
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i