Product Added to your Cart
x

-------- OR --------

GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
Menu
0 items
Wax Melts
51 product(s) found for "Wax Melts"
Dragon's Blood Soy Wax Snap ..
Wax Melts
Dragon's Blood Soy Wax Snap ..
Dragon's Blood Soy Wax Snap Disc - Unleash the Fire Within Awaken your inner dragon with this intoxicating Dragon's Blood wax melt that channels the legendary power and mystique of ancient dragon magic....
£4.99
Units in Stock: 1
£4.99
Details
Add To Cart
Dragon's Blood Soy Wax Snap Disc - Unleash the Fire Within Awaken your inner dragon with this intoxicating Dragon's Blood wax melt that channels the legendary power and mystique of ancient dragon magic....
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i